PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00051145001
Common NameGSBRNA2T00051145001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 128aa    MW: 14552.8 Da    PI: 7.3027
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00051145001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26080.82.1e-25131122101
               DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                          C++C   ++ C+++C +a yfp+e +++++++ klFG++n++++++ +++e+ + ++ss++ e+ a+++d ++G +gvi+kl ++++ ++
  GSBRNA2T00051145001  13 CCVCIEENKICTRKCEFAAYFPNEVQSDYEAATKLFGTTNIISMMNLASHEQNHLLASSILKEGAAWTDDNIRGGYGVIQKLMWEIKLHE 102
                          ****************************************************************************************** PP

               DUF260  92 aelallkeel 101
                          a l+++k+++
  GSBRNA2T00051145001 103 AYLSERKKKI 112
                          ****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.14511112IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-2113108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MEALRTDSKR GCCCVCIEEN KICTRKCEFA AYFPNEVQSD YEAATKLFGT TNIISMMNLA  60
SHEQNHLLAS SILKEGAAWT DDNIRGGYGV IQKLMWEIKL HEAYLSERKK KISEEKKQIV  120
LLLNQYI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607622.12e-90PREDICTED: LOB domain-containing protein 5-like
RefseqXP_013668601.11e-89PREDICTED: uncharacterized protein LOC106372884
SwissprotQ9C8V82e-39LBD5_ARATH; LOB domain-containing protein 5
TrEMBLA0A078JEG23e-91A0A078JEG2_BRANA; BnaUnng01320D protein
STRINGAT1G36000.14e-37(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G36000.11e-40LOB domain-containing protein 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]